Placeholder image of a protein
Icon representing a puzzle

1649: Unsolved De-novo Freestyle 149

Closed since about 7 years ago

Intermediate Overall Prediction

Summary


Created
March 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEVLYLKDADVEQVVRYIRQKNAEVLVVVVNFDEEQIRIIVRVVIQIVQAEVVIVVINMEEEQVKKVVNQVNVKVVVVIK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,434
  2. Avatar for Go Science 2. Go Science 74 pts. 10,322
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,280
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 10,222
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 9,932
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,894
  7. Avatar for Russian team 7. Russian team 12 pts. 9,741
  8. Avatar for Contenders 8. Contenders 8 pts. 9,622
  9. Avatar for Marvin's bunch 9. Marvin's bunch 5 pts. 9,491
  10. Avatar for HMT heritage 10. HMT heritage 3 pts. 9,386

  1. Avatar for spvincent 61. spvincent Lv 1 4 pts. 8,732
  2. Avatar for pfirth 62. pfirth Lv 1 4 pts. 8,676
  3. Avatar for cinnamonkitty 63. cinnamonkitty Lv 1 3 pts. 8,657
  4. Avatar for Hollinas 64. Hollinas Lv 1 3 pts. 8,626
  5. Avatar for MrZanav 65. MrZanav Lv 1 3 pts. 8,623
  6. Avatar for ManVsYard 66. ManVsYard Lv 1 3 pts. 8,590
  7. Avatar for navn 67. navn Lv 1 3 pts. 8,533
  8. Avatar for oureion 68. oureion Lv 1 2 pts. 8,532
  9. Avatar for Rastamasta 69. Rastamasta Lv 1 2 pts. 8,477
  10. Avatar for lconor 70. lconor Lv 1 2 pts. 8,470

Comments