Placeholder image of a protein
Icon representing a puzzle

1649: Unsolved De-novo Freestyle 149

Closed since about 7 years ago

Intermediate Overall Prediction

Summary


Created
March 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEVLYLKDADVEQVVRYIRQKNAEVLVVVVNFDEEQIRIIVRVVIQIVQAEVVIVVINMEEEQVKKVVNQVNVKVVVVIK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,434
  2. Avatar for Go Science 2. Go Science 74 pts. 10,322
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,280
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 10,222
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 9,932
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,894
  7. Avatar for Russian team 7. Russian team 12 pts. 9,741
  8. Avatar for Contenders 8. Contenders 8 pts. 9,622
  9. Avatar for Marvin's bunch 9. Marvin's bunch 5 pts. 9,491
  10. Avatar for HMT heritage 10. HMT heritage 3 pts. 9,386

  1. Avatar for boondog 71. boondog Lv 1 2 pts. 8,458
  2. Avatar for Steven Pletsch 72. Steven Pletsch Lv 1 2 pts. 8,346
  3. Avatar for Threeoak 73. Threeoak Lv 1 2 pts. 8,328
  4. Avatar for felixxy 74. felixxy Lv 1 2 pts. 8,321
  5. Avatar for cbwest 75. cbwest Lv 1 1 pt. 8,307
  6. Avatar for tjonesster 76. tjonesster Lv 1 1 pt. 8,304
  7. Avatar for rabamino12358 77. rabamino12358 Lv 1 1 pt. 8,262
  8. Avatar for diamonddays 78. diamonddays Lv 1 1 pt. 8,244
  9. Avatar for Squirrely 79. Squirrely Lv 1 1 pt. 8,234
  10. Avatar for rezaefar 80. rezaefar Lv 1 1 pt. 8,191

Comments