Placeholder image of a protein
Icon representing a puzzle

1651: Revisiting Puzzle 114: Black Mamba

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
March 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 3 pts. 10,744
  2. Avatar for HMT heritage 12. HMT heritage 2 pts. 10,651
  3. Avatar for FoldIt@Poland 13. FoldIt@Poland 1 pt. 9,880
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,827
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,768
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,756
  7. Avatar for freefolder 17. freefolder 1 pt. 9,516
  8. Avatar for SHELL 18. SHELL 1 pt. 9,172
  9. Avatar for I3L GANG 19. I3L GANG 1 pt. 9,130
  10. Avatar for Dr. B Orgo 2 20. Dr. B Orgo 2 1 pt. 8,563
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,250
  2. Avatar for Deleted player 2. Deleted player pts. 11,178
  3. Avatar for Aubade01 3. Aubade01 Lv 1 93 pts. 11,166
  4. Avatar for Galaxie 4. Galaxie Lv 1 90 pts. 11,141
  5. Avatar for jausmh 5. jausmh Lv 1 87 pts. 11,126
  6. Avatar for smilingone 6. smilingone Lv 1 84 pts. 11,124
  7. Avatar for jobo0502 7. jobo0502 Lv 1 81 pts. 11,118
  8. Avatar for Timo van der Laan 8. Timo van der Laan Lv 1 78 pts. 11,106
  9. Avatar for robgee 9. robgee Lv 1 75 pts. 11,087
  10. Avatar for christioanchauvin 10. christioanchauvin Lv 1 72 pts. 11,086

Comments

GeologyJoel Lv 1

How do I play when the program gives an error message: Peer certificate cannot be authenticated with given CA certificates…

What's the protocol for solving this issue?

frood66 Lv 1

would we be right in assuming that the issues with in game and site scores will be sorted here shortly?

Or are we all wasting our time?