Placeholder image of a protein
Icon representing a puzzle

1651: Revisiting Puzzle 114: Black Mamba

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
March 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Beta Folders 100 pts. 11,252
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 77 pts. 11,183
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 11,126
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 11,118
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 11,106
  6. Avatar for Gargleblasters 6. Gargleblasters 22 pts. 11,091
  7. Avatar for Go Science 7. Go Science 15 pts. 11,086
  8. Avatar for Contenders 8. Contenders 11 pts. 11,029
  9. Avatar for Russian team 9. Russian team 7 pts. 10,964
  10. Avatar for GENE 433 10. GENE 433 5 pts. 10,784

  1. Avatar for cbwest 51. cbwest Lv 1 11 pts. 10,679
  2. Avatar for katling 52. katling Lv 1 10 pts. 10,664
  3. Avatar for O Seki To 53. O Seki To Lv 1 10 pts. 10,651
  4. Avatar for nicobul 54. nicobul Lv 1 9 pts. 10,648
  5. Avatar for timroberts16 55. timroberts16 Lv 1 9 pts. 10,604
  6. Avatar for altejoh 56. altejoh Lv 1 8 pts. 10,590
  7. Avatar for carsonfb 57. carsonfb Lv 1 8 pts. 10,569
  8. Avatar for TastyMunchies 58. TastyMunchies Lv 1 7 pts. 10,517
  9. Avatar for ViJay7019 59. ViJay7019 Lv 1 7 pts. 10,457
  10. Avatar for lconor 60. lconor Lv 1 7 pts. 10,428

Comments


GeologyJoel Lv 1

How do I play when the program gives an error message: Peer certificate cannot be authenticated with given CA certificates…

What's the protocol for solving this issue?

frood66 Lv 1

would we be right in assuming that the issues with in game and site scores will be sorted here shortly?

Or are we all wasting our time?