Placeholder image of a protein
Icon representing a puzzle

1651: Revisiting Puzzle 114: Black Mamba

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
March 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,252
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 77 pts. 11,183
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 11,126
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 11,118
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 11,106
  6. Avatar for Gargleblasters 6. Gargleblasters 22 pts. 11,091
  7. Avatar for Go Science 7. Go Science 15 pts. 11,086
  8. Avatar for Contenders 8. Contenders 11 pts. 11,029
  9. Avatar for Russian team 9. Russian team 7 pts. 10,964
  10. Avatar for GENE 433 10. GENE 433 5 pts. 10,784
  1. Avatar for ourtown 91. ourtown Lv 1 1 pt. 9,617
  2. Avatar for Lyshi2018 92. Lyshi2018 Lv 1 1 pt. 9,608
  3. Avatar for ti_go_Mars 93. ti_go_Mars Lv 1 1 pt. 9,547
  4. Avatar for Knoblerine 94. Knoblerine Lv 1 1 pt. 9,539
  5. Avatar for alwan2018 95. alwan2018 Lv 1 1 pt. 9,532
  6. Avatar for Altercomp 96. Altercomp Lv 1 1 pt. 9,516
  7. Avatar for memam2018 97. memam2018 Lv 1 1 pt. 9,509
  8. Avatar for hada 98. hada Lv 1 1 pt. 9,486
  9. Avatar for martinf 99. martinf Lv 1 1 pt. 9,475
  10. Avatar for Squirrely 100. Squirrely Lv 1 1 pt. 9,437

Comments

GeologyJoel Lv 1

How do I play when the program gives an error message: Peer certificate cannot be authenticated with given CA certificates…

What's the protocol for solving this issue?

frood66 Lv 1

would we be right in assuming that the issues with in game and site scores will be sorted here shortly?

Or are we all wasting our time?