Placeholder image of a protein
Icon representing a puzzle

1652: Unsolved De-novo Freestyle 149: Symmetric Dimer

Closed since about 7 years ago

Intermediate Overall Prediction Symmetry

Summary

Created
March 21, 2019
Expires
Max points
100
Description

This is a follow-up to Puzzle 1649: De-novo Freestyle 149, now with C2 symmetry. This protein was originally designed by a Foldit player as a symmetric dimer. In Puzzle 1649, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the original protein was designed to fold and bind to itself with C2 symmetry. Players may load in solutions from Puzzle 1649. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEVLYLKDADVEQVVRYIRQKNAEVLVVVVNFDEEQIRIIVRVVIQIVQAEVVIVVINMEEEQVKKVVNQVNVKVVVVIK

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 10,656
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 10,622
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,453
  4. Avatar for I3L GANG 14. I3L GANG 1 pt. 9,043
  5. Avatar for freefolder 15. freefolder 1 pt. 3,418
  6. Avatar for SHELL 16. SHELL 1 pt. 2,775
  1. Avatar for abiogenesis 81. abiogenesis Lv 1 1 pt. 7,379
  2. Avatar for tarimo 82. tarimo Lv 1 1 pt. 7,157
  3. Avatar for felixxy 83. felixxy Lv 1 1 pt. 6,791
  4. Avatar for hexidecimalhack 84. hexidecimalhack Lv 1 1 pt. 5,212
  5. Avatar for boondog 85. boondog Lv 1 1 pt. 3,855
  6. Avatar for Philippe_C 86. Philippe_C Lv 1 1 pt. 3,833
  7. Avatar for Altercomp 87. Altercomp Lv 1 1 pt. 3,418
  8. Avatar for Jiarong 88. Jiarong Lv 1 1 pt. 2,775
  9. Avatar for altejoh 89. altejoh Lv 1 1 pt. 2,608
  10. Avatar for sir benn 90. sir benn Lv 1 1 pt. 2,036

Comments