Placeholder image of a protein
Icon representing a puzzle

1656: Revisiting Puzzle 117: Transport Mutant

Closed since about 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 3 pts. 9,635
  2. Avatar for GENE 433 12. GENE 433 2 pts. 9,559
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,504
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,353
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 9,313
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 9,306
  7. Avatar for freefolder 17. freefolder 1 pt. 9,277
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 8,943
  9. Avatar for Italiani Al Lavoro 19. Italiani Al Lavoro 1 pt. 8,938
  10. Avatar for SHELL 20. SHELL 1 pt. 8,464

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,768
  2. Avatar for phi16 2. phi16 Lv 1 81 pts. 9,765
  3. Avatar for LociOiling 3. LociOiling Lv 1 64 pts. 9,763
  4. Avatar for robgee 4. robgee Lv 1 50 pts. 9,763
  5. Avatar for smilingone 5. smilingone Lv 1 39 pts. 9,761
  6. Avatar for tyler0911 6. tyler0911 Lv 1 30 pts. 9,760
  7. Avatar for Deleted player 7. Deleted player pts. 9,754
  8. Avatar for lamoille 8. lamoille Lv 1 17 pts. 9,752
  9. Avatar for alwen 9. alwen Lv 1 12 pts. 9,746
  10. Avatar for alcor29 10. alcor29 Lv 1 9 pts. 9,743

Comments