Placeholder image of a protein
Icon representing a puzzle

1656: Revisiting Puzzle 117: Transport Mutant

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
April 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 3 pts. 9,635
  2. Avatar for GENE 433 12. GENE 433 2 pts. 9,559
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,504
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,353
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 9,313
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 9,306
  7. Avatar for freefolder 17. freefolder 1 pt. 9,277
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 8,943
  9. Avatar for Italiani Al Lavoro 19. Italiani Al Lavoro 1 pt. 8,938
  10. Avatar for SHELL 20. SHELL 1 pt. 8,464
  1. Avatar for monteecristo 91. monteecristo Lv 1 2 pts. 9,356
  2. Avatar for MrZanav 92. MrZanav Lv 1 2 pts. 9,354
  3. Avatar for Lyshi2018 93. Lyshi2018 Lv 1 1 pt. 9,353
  4. Avatar for Arne Heessels 94. Arne Heessels Lv 1 1 pt. 9,342
  5. Avatar for Joanvl 95. Joanvl Lv 1 1 pt. 9,340
  6. Avatar for xBIOCHEMISTx 96. xBIOCHEMISTx Lv 1 1 pt. 9,325
  7. Avatar for lconor 97. lconor Lv 1 1 pt. 9,321
  8. Avatar for ironchefnorse 98. ironchefnorse Lv 1 1 pt. 9,318
  9. Avatar for oureion 99. oureion Lv 1 1 pt. 9,313
  10. Avatar for harvardman 100. harvardman Lv 1 1 pt. 9,311

Comments