Placeholder image of a protein
Icon representing a puzzle

1656: Revisiting Puzzle 117: Transport Mutant

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 3 pts. 9,635
  2. Avatar for GENE 433 12. GENE 433 2 pts. 9,559
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,504
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,353
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 9,313
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 9,306
  7. Avatar for freefolder 17. freefolder 1 pt. 9,277
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 8,943
  9. Avatar for Italiani Al Lavoro 19. Italiani Al Lavoro 1 pt. 8,938
  10. Avatar for SHELL 20. SHELL 1 pt. 8,464
  1. Avatar for actiasluna 21. actiasluna Lv 1 50 pts. 9,728
  2. Avatar for reefyrob 22. reefyrob Lv 1 48 pts. 9,727
  3. Avatar for silent gene 23. silent gene Lv 1 46 pts. 9,726
  4. Avatar for johnmitch 24. johnmitch Lv 1 45 pts. 9,724
  5. Avatar for Deleted player 25. Deleted player pts. 9,720
  6. Avatar for Bruno Kestemont 26. Bruno Kestemont Lv 1 41 pts. 9,718
  7. Avatar for jobo0502 27. jobo0502 Lv 1 40 pts. 9,717
  8. Avatar for crpainter 28. crpainter Lv 1 38 pts. 9,717
  9. Avatar for rezaefar 29. rezaefar Lv 1 37 pts. 9,715
  10. Avatar for zgf2022 30. zgf2022 Lv 1 35 pts. 9,713

Comments