Placeholder image of a protein
Icon representing a puzzle

1656: Revisiting Puzzle 117: Transport Mutant

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
April 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 3 pts. 9,635
  2. Avatar for GENE 433 12. GENE 433 2 pts. 9,559
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,504
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,353
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 9,313
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 9,306
  7. Avatar for freefolder 17. freefolder 1 pt. 9,277
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 8,943
  9. Avatar for Italiani Al Lavoro 19. Italiani Al Lavoro 1 pt. 8,938
  10. Avatar for SHELL 20. SHELL 1 pt. 8,464
  1. Avatar for carsonfb 71. carsonfb Lv 1 5 pts. 9,516
  2. Avatar for stomjoh 72. stomjoh Lv 1 5 pts. 9,509
  3. Avatar for Vinara 73. Vinara Lv 1 5 pts. 9,508
  4. Avatar for Hiro Protagonist 74. Hiro Protagonist Lv 1 4 pts. 9,504
  5. Avatar for tomespen 75. tomespen Lv 1 4 pts. 9,504
  6. Avatar for ViJay7019 76. ViJay7019 Lv 1 4 pts. 9,495
  7. Avatar for ourtown 77. ourtown Lv 1 4 pts. 9,471
  8. Avatar for benrh 78. benrh Lv 1 3 pts. 9,465
  9. Avatar for Maerlyn138 79. Maerlyn138 Lv 1 3 pts. 9,458
  10. Avatar for ComputerMage 80. ComputerMage Lv 1 3 pts. 9,441

Comments