Placeholder image of a protein
Icon representing a puzzle

1656: Revisiting Puzzle 117: Transport Mutant

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
April 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,768
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,765
  3. Avatar for HMT heritage 3. HMT heritage 58 pts. 9,756
  4. Avatar for Contenders 4. Contenders 43 pts. 9,751
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 9,746
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,746
  7. Avatar for Go Science 7. Go Science 15 pts. 9,741
  8. Avatar for Marvin's bunch 8. Marvin's bunch 11 pts. 9,738
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 7 pts. 9,717
  10. Avatar for Russian team 10. Russian team 5 pts. 9,709

  1. Avatar for monteecristo 91. monteecristo Lv 1 2 pts. 9,356
  2. Avatar for MrZanav 92. MrZanav Lv 1 2 pts. 9,354
  3. Avatar for Lyshi2018 93. Lyshi2018 Lv 1 1 pt. 9,353
  4. Avatar for Arne Heessels 94. Arne Heessels Lv 1 1 pt. 9,342
  5. Avatar for Joanvl 95. Joanvl Lv 1 1 pt. 9,340
  6. Avatar for xBIOCHEMISTx 96. xBIOCHEMISTx Lv 1 1 pt. 9,325
  7. Avatar for lconor 97. lconor Lv 1 1 pt. 9,321
  8. Avatar for ironchefnorse 98. ironchefnorse Lv 1 1 pt. 9,318
  9. Avatar for oureion 99. oureion Lv 1 1 pt. 9,313
  10. Avatar for harvardman 100. harvardman Lv 1 1 pt. 9,311

Comments