Placeholder image of a protein
Icon representing a puzzle

1656: Revisiting Puzzle 117: Transport Mutant

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
April 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,768
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,765
  3. Avatar for HMT heritage 3. HMT heritage 58 pts. 9,756
  4. Avatar for Contenders 4. Contenders 43 pts. 9,751
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 9,746
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,746
  7. Avatar for Go Science 7. Go Science 15 pts. 9,741
  8. Avatar for Marvin's bunch 8. Marvin's bunch 11 pts. 9,738
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 7 pts. 9,717
  10. Avatar for Russian team 10. Russian team 5 pts. 9,709

  1. Avatar for carsonfb 71. carsonfb Lv 1 5 pts. 9,516
  2. Avatar for stomjoh 72. stomjoh Lv 1 5 pts. 9,509
  3. Avatar for Vinara 73. Vinara Lv 1 5 pts. 9,508
  4. Avatar for Hiro Protagonist 74. Hiro Protagonist Lv 1 4 pts. 9,504
  5. Avatar for tomespen 75. tomespen Lv 1 4 pts. 9,504
  6. Avatar for ViJay7019 76. ViJay7019 Lv 1 4 pts. 9,495
  7. Avatar for ourtown 77. ourtown Lv 1 4 pts. 9,471
  8. Avatar for benrh 78. benrh Lv 1 3 pts. 9,465
  9. Avatar for Maerlyn138 79. Maerlyn138 Lv 1 3 pts. 9,458
  10. Avatar for ComputerMage 80. ComputerMage Lv 1 3 pts. 9,441

Comments