Placeholder image of a protein
Icon representing a puzzle

1663: Revisiting Puzzle 125: Ice Binding Protein

Closed since about 7 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
April 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,032
  2. Avatar for GENE 433 12. GENE 433 1 pt. 9,932
  3. Avatar for freefolder 13. freefolder 1 pt. 9,835
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 9,823
  5. Avatar for DW 2020 15. DW 2020 1 pt. 9,811
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 9,704
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 9,410
  8. Avatar for Italiani Al Lavoro 18. Italiani Al Lavoro 1 pt. 9,135
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,365
  1. Avatar for retiredmichael
    1. retiredmichael Lv 1
    100 pts. 10,167
  2. Avatar for Aubade01 2. Aubade01 Lv 1 97 pts. 10,161
  3. Avatar for Timo van der Laan 3. Timo van der Laan Lv 1 94 pts. 10,159
  4. Avatar for Galaxie 4. Galaxie Lv 1 90 pts. 10,157
  5. Avatar for tyler0911 5. tyler0911 Lv 1 87 pts. 10,153
  6. Avatar for christioanchauvin 6. christioanchauvin Lv 1 84 pts. 10,136
  7. Avatar for johnmitch 7. johnmitch Lv 1 81 pts. 10,123
  8. Avatar for Deleted player 8. Deleted player pts. 10,121
  9. Avatar for robgee 9. robgee Lv 1 75 pts. 10,119
  10. Avatar for Deleted player 10. Deleted player pts. 10,118

Comments