Placeholder image of a protein
Icon representing a puzzle

1663: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,032
  2. Avatar for GENE 433 12. GENE 433 1 pt. 9,932
  3. Avatar for freefolder 13. freefolder 1 pt. 9,835
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 9,823
  5. Avatar for DW 2020 15. DW 2020 1 pt. 9,811
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 9,704
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 9,410
  8. Avatar for Italiani Al Lavoro 18. Italiani Al Lavoro 1 pt. 9,135
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,365
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,170
  2. Avatar for Galaxie 2. Galaxie Lv 1 77 pts. 10,170
  3. Avatar for robgee 3. robgee Lv 1 58 pts. 10,165
  4. Avatar for reefyrob 4. reefyrob Lv 1 43 pts. 10,161
  5. Avatar for phi16 5. phi16 Lv 1 31 pts. 10,151
  6. Avatar for Deleted player 6. Deleted player pts. 10,139
  7. Avatar for actiasluna 7. actiasluna Lv 1 15 pts. 10,135
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 11 pts. 10,131
  9. Avatar for toshiue 9. toshiue Lv 1 7 pts. 10,125
  10. Avatar for silent gene 10. silent gene Lv 1 5 pts. 10,124

Comments