Placeholder image of a protein
Icon representing a puzzle

1663: Revisiting Puzzle 125: Ice Binding Protein

Closed since about 7 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Beta Folders 100 pts. 10,170
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,170
  3. Avatar for Void Crushers 3. Void Crushers 56 pts. 10,159
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 10,136
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 10,135
  6. Avatar for Go Science 6. Go Science 20 pts. 10,131
  7. Avatar for Contenders 7. Contenders 14 pts. 10,115
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 10,094
  9. Avatar for Russian team 9. Russian team 6 pts. 10,076
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,052

  1. Avatar for alwen 11. alwen Lv 1 3 pts. 10,121
  2. Avatar for NinjaGreg 12. NinjaGreg Lv 1 2 pts. 10,120
  3. Avatar for lamoille 13. lamoille Lv 1 1 pt. 10,118
  4. Avatar for alcor29 14. alcor29 Lv 1 1 pt. 10,101
  5. Avatar for Maerlyn138 15. Maerlyn138 Lv 1 1 pt. 10,068
  6. Avatar for Steven Pletsch 16. Steven Pletsch Lv 1 1 pt. 10,032
  7. Avatar for jausmh 17. jausmh Lv 1 1 pt. 10,015
  8. Avatar for Sissue 19. Sissue Lv 1 1 pt. 9,872
  9. Avatar for orily1337 20. orily1337 Lv 1 1 pt. 9,653

Comments