Placeholder image of a protein
Icon representing a puzzle

1663: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
April 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Beta Folders 100 pts. 10,170
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,170
  3. Avatar for Void Crushers 3. Void Crushers 56 pts. 10,159
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 10,136
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 10,135
  6. Avatar for Go Science 6. Go Science 20 pts. 10,131
  7. Avatar for Contenders 7. Contenders 14 pts. 10,115
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 10,094
  9. Avatar for Russian team 9. Russian team 6 pts. 10,076
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,052

  1. Avatar for Cloudy_Tiger 71. Cloudy_Tiger Lv 1 4 pts. 9,775
  2. Avatar for vizhu2018 72. vizhu2018 Lv 1 4 pts. 9,769
  3. Avatar for Crossed Sticks 73. Crossed Sticks Lv 1 3 pts. 9,768
  4. Avatar for joaniegirl 74. joaniegirl Lv 1 3 pts. 9,766
  5. Avatar for heather-1 75. heather-1 Lv 1 3 pts. 9,748
  6. Avatar for lconor 77. lconor Lv 1 3 pts. 9,711
  7. Avatar for roman madala 78. roman madala Lv 1 2 pts. 9,705
  8. Avatar for UnderPowered 79. UnderPowered Lv 1 2 pts. 9,704
  9. Avatar for kludbrook 80. kludbrook Lv 1 2 pts. 9,688

Comments