Placeholder image of a protein
Icon representing a puzzle

1663: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
April 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,170
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,170
  3. Avatar for Void Crushers 3. Void Crushers 56 pts. 10,159
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 10,136
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 10,135
  6. Avatar for Go Science 6. Go Science 20 pts. 10,131
  7. Avatar for Contenders 7. Contenders 14 pts. 10,115
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 10,094
  9. Avatar for Russian team 9. Russian team 6 pts. 10,076
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,052
  1. Avatar for Hellcat6 81. Hellcat6 Lv 1 2 pts. 9,682
  2. Avatar for orily1337 82. orily1337 Lv 1 2 pts. 9,681
  3. Avatar for SiPot2018 83. SiPot2018 Lv 1 2 pts. 9,666
  4. Avatar for Arne Heessels 84. Arne Heessels Lv 1 2 pts. 9,654
  5. Avatar for Dantoto 85. Dantoto Lv 1 2 pts. 9,645
  6. Avatar for ralan-nsk 86. ralan-nsk Lv 1 1 pt. 9,641
  7. Avatar for TastyMunchies 87. TastyMunchies Lv 1 1 pt. 9,599
  8. Avatar for drcliff 88. drcliff Lv 1 1 pt. 9,594
  9. Avatar for Steven Pletsch 89. Steven Pletsch Lv 1 1 pt. 9,590
  10. Avatar for Natuhaka 90. Natuhaka Lv 1 1 pt. 9,541

Comments