Placeholder image of a protein
Icon representing a puzzle

1666: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since almost 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
April 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 2 pts. 10,220
  2. Avatar for Contenders 12. Contenders 1 pt. 10,216
  3. Avatar for GENE 433 13. GENE 433 1 pt. 9,798
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,074
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,970
  6. Avatar for I3L GANG 17. I3L GANG 1 pt. 8,451
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,939

  1. Avatar for Crossed Sticks 131. Crossed Sticks Lv 1 1 pt. 7,877
  2. Avatar for candicetambaoan 132. candicetambaoan Lv 1 1 pt. 7,851
  3. Avatar for Inkedhands 133. Inkedhands Lv 1 1 pt. 7,762
  4. Avatar for Ksenija 134. Ksenija Lv 1 1 pt. 7,747
  5. Avatar for janikavillamor 135. janikavillamor Lv 1 1 pt. 7,577
  6. Avatar for Tehnologik1 136. Tehnologik1 Lv 1 1 pt. 7,368
  7. Avatar for ITFS2019 137. ITFS2019 Lv 1 1 pt. 7,346
  8. Avatar for wozzarelli 138. wozzarelli Lv 1 1 pt. 6,856
  9. Avatar for Neil9 139. Neil9 Lv 1 1 pt. 6,384
  10. Avatar for ayyu 140. ayyu Lv 1 1 pt. 6,108

Comments