Placeholder image of a protein
Icon representing a puzzle

1666: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
April 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 2 pts. 10,220
  2. Avatar for Contenders 12. Contenders 1 pt. 10,216
  3. Avatar for GENE 433 13. GENE 433 1 pt. 9,798
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,074
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,970
  6. Avatar for I3L GANG 17. I3L GANG 1 pt. 8,451
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,939

  1. Avatar for tarimo 41. tarimo Lv 1 22 pts. 10,109
  2. Avatar for diamonddays 42. diamonddays Lv 1 21 pts. 10,088
  3. Avatar for cbwest 43. cbwest Lv 1 20 pts. 10,077
  4. Avatar for manu8170 44. manu8170 Lv 1 19 pts. 10,000
  5. Avatar for ReallyRatherDumb 45. ReallyRatherDumb Lv 1 18 pts. 9,994
  6. Avatar for rezaefar 46. rezaefar Lv 1 17 pts. 9,975
  7. Avatar for kludbrook 47. kludbrook Lv 1 17 pts. 9,961
  8. Avatar for WBarme1234 48. WBarme1234 Lv 1 16 pts. 9,917
  9. Avatar for Anfinsen_slept_here 49. Anfinsen_slept_here Lv 1 15 pts. 9,897
  10. Avatar for fiendish_ghoul 50. fiendish_ghoul Lv 1 14 pts. 9,897

Comments