Placeholder image of a protein
Icon representing a puzzle

1666: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 2 pts. 10,220
  2. Avatar for Contenders 12. Contenders 1 pt. 10,216
  3. Avatar for GENE 433 13. GENE 433 1 pt. 9,798
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,074
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,970
  6. Avatar for Richard Dawkins Foundation 16. Richard Dawkins Foundation 1 pt. 8,879
  7. Avatar for I3L GANG 17. I3L GANG 1 pt. 8,451
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,939
  1. Avatar for Alpha-KetoGlutarate1301 81. Alpha-KetoGlutarate1301 Lv 1 3 pts. 9,223
  2. Avatar for Simek 82. Simek Lv 1 3 pts. 9,167
  3. Avatar for harvardman 83. harvardman Lv 1 2 pts. 9,162
  4. Avatar for Knoblerine 84. Knoblerine Lv 1 2 pts. 9,110
  5. Avatar for martin.kendig@verizon.net 85. martin.kendig@verizon.net Lv 1 2 pts. 9,106
  6. Avatar for rinze 86. rinze Lv 1 2 pts. 9,090
  7. Avatar for oureion 87. oureion Lv 1 2 pts. 9,074
  8. Avatar for lconor 88. lconor Lv 1 2 pts. 9,053
  9. Avatar for JasperD 89. JasperD Lv 1 2 pts. 9,050
  10. Avatar for felixxy 90. felixxy Lv 1 2 pts. 9,019

Comments