Placeholder image of a protein
Icon representing a puzzle

1666: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
April 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for Beta Folders 100 pts. 10,906
  2. Avatar for Go Science 2. Go Science 74 pts. 10,738
  3. Avatar for FoldIt@Netherlands 3. FoldIt@Netherlands 54 pts. 10,713
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 10,638
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 10,614
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 10,573
  7. Avatar for HMT heritage 7. HMT heritage 12 pts. 10,485
  8. Avatar for Hold My Beer 8. Hold My Beer 8 pts. 10,362
  9. Avatar for Russian team 9. Russian team 5 pts. 10,333
  10. Avatar for Marvin's bunch 10. Marvin's bunch 3 pts. 10,309

  1. Avatar for gzahoranszky 151. gzahoranszky Lv 1 1 pt. 0

Comments