Placeholder image of a protein
Icon representing a puzzle

1668: Revisiting Puzzle 134: Rice

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 29, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 3 pts. 9,568
  2. Avatar for freefolder 12. freefolder 2 pts. 9,361
  3. Avatar for GENE 433 13. GENE 433 1 pt. 9,192
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,798
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,723
  6. Avatar for MBB190 16. MBB190 1 pt. 8,111
  7. Avatar for Atheists, Skeptics, & Humanists 17. Atheists, Skeptics, & Humanists 1 pt. 7,372
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 7,345
  9. Avatar for I3L GANG 19. I3L GANG 1 pt. 6,991
  10. Avatar for Deleted group 20. Deleted group pts. 2,801
  1. Avatar for ManVsYard 91. ManVsYard Lv 1 2 pts. 8,594
  2. Avatar for MrZanav 92. MrZanav Lv 1 2 pts. 8,576
  3. Avatar for Knoblerine 93. Knoblerine Lv 1 2 pts. 8,564
  4. Avatar for felixxy 94. felixxy Lv 1 2 pts. 8,556
  5. Avatar for rol 95. rol Lv 1 2 pts. 8,542
  6. Avatar for jdmclure 96. jdmclure Lv 1 2 pts. 8,523
  7. Avatar for rabamino12358 97. rabamino12358 Lv 1 2 pts. 8,521
  8. Avatar for junsuha 98. junsuha Lv 1 1 pt. 8,510
  9. Avatar for fenecoo 99. fenecoo Lv 1 1 pt. 8,479
  10. Avatar for frostschutz 100. frostschutz Lv 1 1 pt. 8,363

Comments