Placeholder image of a protein
Icon representing a puzzle

1668: Revisiting Puzzle 134: Rice

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
April 29, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 3 pts. 9,568
  2. Avatar for freefolder 12. freefolder 2 pts. 9,361
  3. Avatar for GENE 433 13. GENE 433 1 pt. 9,192
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,798
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,723
  6. Avatar for MBB190 16. MBB190 1 pt. 8,111
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 7,345
  8. Avatar for I3L GANG 19. I3L GANG 1 pt. 6,991
  9. Avatar for Deleted group 20. Deleted group pts. 2,801

  1. Avatar for alyssazaye 151. alyssazaye Lv 1 1 pt. 6,419
  2. Avatar for Elijah Flores 152. Elijah Flores Lv 1 1 pt. 6,415
  3. Avatar for harvardman 153. harvardman Lv 1 1 pt. 6,345
  4. Avatar for luisa.rs 154. luisa.rs Lv 1 1 pt. 6,324
  5. Avatar for 01010011111 155. 01010011111 Lv 1 1 pt. 5,887
  6. Avatar for RockOn 156. RockOn Lv 1 1 pt. 5,779
  7. Avatar for Maerlyn138 157. Maerlyn138 Lv 1 1 pt. 4,118
  8. Avatar for orily1337 158. orily1337 Lv 1 1 pt. 2,801
  9. Avatar for horowsah 159. horowsah Lv 1 1 pt. 2,801
  10. Avatar for Reuben_Allen 160. Reuben_Allen Lv 1 1 pt. 2,801

Comments