Placeholder image of a protein
Icon representing a puzzle

1668: Revisiting Puzzle 134: Rice

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 29, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 3 pts. 9,568
  2. Avatar for freefolder 12. freefolder 2 pts. 9,361
  3. Avatar for GENE 433 13. GENE 433 1 pt. 9,192
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,798
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,723
  6. Avatar for MBB190 16. MBB190 1 pt. 8,111
  7. Avatar for Atheists, Skeptics, & Humanists 17. Atheists, Skeptics, & Humanists 1 pt. 7,372
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 7,345
  9. Avatar for I3L GANG 19. I3L GANG 1 pt. 6,991
  10. Avatar for Deleted group 20. Deleted group pts. 2,801
  1. Avatar for Deleted player 21. Deleted player pts. 10,313
  2. Avatar for Flagg65a 22. Flagg65a Lv 1 50 pts. 10,288
  3. Avatar for crpainter 23. crpainter Lv 1 48 pts. 10,285
  4. Avatar for Timo van der Laan 24. Timo van der Laan Lv 1 47 pts. 10,279
  5. Avatar for christioanchauvin 25. christioanchauvin Lv 1 45 pts. 10,270
  6. Avatar for Bletchley Park 26. Bletchley Park Lv 1 44 pts. 10,264
  7. Avatar for NinjaGreg 27. NinjaGreg Lv 1 42 pts. 10,263
  8. Avatar for Skippysk8s 28. Skippysk8s Lv 1 40 pts. 10,259
  9. Avatar for guineapig 29. guineapig Lv 1 39 pts. 10,256
  10. Avatar for anthion 30. anthion Lv 1 38 pts. 10,254

Comments