Placeholder image of a protein
Icon representing a puzzle

1668: Revisiting Puzzle 134: Rice

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 29, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 3 pts. 9,568
  2. Avatar for freefolder 12. freefolder 2 pts. 9,361
  3. Avatar for GENE 433 13. GENE 433 1 pt. 9,192
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,798
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,723
  6. Avatar for MBB190 16. MBB190 1 pt. 8,111
  7. Avatar for Atheists, Skeptics, & Humanists 17. Atheists, Skeptics, & Humanists 1 pt. 7,372
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 7,345
  9. Avatar for I3L GANG 19. I3L GANG 1 pt. 6,991
  10. Avatar for Deleted group 20. Deleted group pts. 2,801
  1. Avatar for pvc78 31. pvc78 Lv 1 36 pts. 10,236
  2. Avatar for joremen 32. joremen Lv 1 35 pts. 10,229
  3. Avatar for Deleted player 33. Deleted player pts. 10,217
  4. Avatar for Blipperman 34. Blipperman Lv 1 32 pts. 10,196
  5. Avatar for aznarog 35. aznarog Lv 1 31 pts. 10,186
  6. Avatar for Sissue 36. Sissue Lv 1 30 pts. 10,184
  7. Avatar for jausmh 37. jausmh Lv 1 29 pts. 10,175
  8. Avatar for jobo0502 38. jobo0502 Lv 1 28 pts. 10,168
  9. Avatar for Vinara 39. Vinara Lv 1 27 pts. 10,152
  10. Avatar for Marvelz 40. Marvelz Lv 1 25 pts. 10,151

Comments