Placeholder image of a protein
Icon representing a puzzle

1668: Revisiting Puzzle 134: Rice

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
April 29, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,696
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,548
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 10,521
  4. Avatar for Go Science 4. Go Science 43 pts. 10,464
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 10,405
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 10,354
  7. Avatar for Russian team 7. Russian team 15 pts. 10,344
  8. Avatar for Contenders 8. Contenders 11 pts. 10,285
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 10,279
  10. Avatar for HMT heritage 10. HMT heritage 5 pts. 9,684

  1. Avatar for Blipperman 11. Blipperman Lv 1 3 pts. 10,518
  2. Avatar for actiasluna 12. actiasluna Lv 1 2 pts. 10,498
  3. Avatar for Deleted player 13. Deleted player pts. 10,490
  4. Avatar for ManVsYard 14. ManVsYard Lv 1 1 pt. 10,490
  5. Avatar for Skippysk8s 15. Skippysk8s Lv 1 1 pt. 10,478
  6. Avatar for Bruno Kestemont 16. Bruno Kestemont Lv 1 1 pt. 10,464
  7. Avatar for NinjaGreg 17. NinjaGreg Lv 1 1 pt. 10,464
  8. Avatar for silent gene 18. silent gene Lv 1 1 pt. 10,459
  9. Avatar for toshiue 19. toshiue Lv 1 1 pt. 10,428
  10. Avatar for jausmh 20. jausmh Lv 1 1 pt. 10,243

Comments