Placeholder image of a protein
Icon representing a puzzle

1668: Revisiting Puzzle 134: Rice

Closed since almost 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
April 29, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,696
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,548
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 10,521
  4. Avatar for Go Science 4. Go Science 43 pts. 10,464
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 10,405
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 10,354
  7. Avatar for Russian team 7. Russian team 15 pts. 10,344
  8. Avatar for Contenders 8. Contenders 11 pts. 10,285
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 10,279
  10. Avatar for HMT heritage 10. HMT heritage 5 pts. 9,684

  1. Avatar for ManVsYard 91. ManVsYard Lv 1 2 pts. 8,594
  2. Avatar for MrZanav 92. MrZanav Lv 1 2 pts. 8,576
  3. Avatar for Knoblerine 93. Knoblerine Lv 1 2 pts. 8,564
  4. Avatar for felixxy 94. felixxy Lv 1 2 pts. 8,556
  5. Avatar for rol 95. rol Lv 1 2 pts. 8,542
  6. Avatar for jdmclure 96. jdmclure Lv 1 2 pts. 8,523
  7. Avatar for rabamino12358 97. rabamino12358 Lv 1 2 pts. 8,521
  8. Avatar for junsuha 98. junsuha Lv 1 1 pt. 8,510
  9. Avatar for fenecoo 99. fenecoo Lv 1 1 pt. 8,479
  10. Avatar for frostschutz 100. frostschutz Lv 1 1 pt. 8,363

Comments