Placeholder image of a protein
Icon representing a puzzle

1668: Revisiting Puzzle 134: Rice

Closed since almost 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
April 29, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,696
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,548
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 10,521
  4. Avatar for Go Science 4. Go Science 43 pts. 10,464
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 10,405
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 10,354
  7. Avatar for Russian team 7. Russian team 15 pts. 10,344
  8. Avatar for Contenders 8. Contenders 11 pts. 10,285
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 10,279
  10. Avatar for HMT heritage 10. HMT heritage 5 pts. 9,684

  1. Avatar for Threeoak 111. Threeoak Lv 1 1 pt. 8,023
  2. Avatar for lconor 112. lconor Lv 1 1 pt. 8,005
  3. Avatar for nong9090 113. nong9090 Lv 1 1 pt. 7,989
  4. Avatar for roman madala 114. roman madala Lv 1 1 pt. 7,975
  5. Avatar for SiPot2018 115. SiPot2018 Lv 1 1 pt. 7,961
  6. Avatar for ZRGanapin 116. ZRGanapin Lv 1 1 pt. 7,901
  7. Avatar for jerwansyah 117. jerwansyah Lv 1 1 pt. 7,868
  8. Avatar for Dantoto 118. Dantoto Lv 1 1 pt. 7,833
  9. Avatar for ayyu 120. ayyu Lv 1 1 pt. 7,662

Comments