Placeholder image of a protein
Icon representing a puzzle

1668: Revisiting Puzzle 134: Rice

Closed since about 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 29, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,696
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,548
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 10,521
  4. Avatar for Go Science 4. Go Science 43 pts. 10,464
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 10,405
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 10,354
  7. Avatar for Russian team 7. Russian team 15 pts. 10,344
  8. Avatar for Contenders 8. Contenders 11 pts. 10,285
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 10,279
  10. Avatar for HMT heritage 10. HMT heritage 5 pts. 9,684

  1. Avatar for Deleted player 21. Deleted player pts. 10,313
  2. Avatar for Flagg65a 22. Flagg65a Lv 1 50 pts. 10,288
  3. Avatar for crpainter 23. crpainter Lv 1 48 pts. 10,285
  4. Avatar for Timo van der Laan 24. Timo van der Laan Lv 1 47 pts. 10,279
  5. Avatar for christioanchauvin 25. christioanchauvin Lv 1 45 pts. 10,270
  6. Avatar for Bletchley Park 26. Bletchley Park Lv 1 44 pts. 10,264
  7. Avatar for NinjaGreg 27. NinjaGreg Lv 1 42 pts. 10,263
  8. Avatar for Skippysk8s 28. Skippysk8s Lv 1 40 pts. 10,259
  9. Avatar for guineapig 29. guineapig Lv 1 39 pts. 10,256
  10. Avatar for anthion 30. anthion Lv 1 38 pts. 10,254

Comments