Placeholder image of a protein
Icon representing a puzzle

1670: Unsolved De-novo Freestyle 150: Symmetric Dimer

Closed since almost 7 years ago

Intermediate Overall Prediction Symmetry

Summary

Created
May 06, 2019
Expires
Max points
100
Description

This is a follow-up to Puzzle 1657: De-novo Freestyle 150, now with C2 symmetry. This protein was originally designed by a Foldit player as a symmetric dimer. In Puzzle 1657, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the original protein was designed to fold and bind to itself with C2 symmetry. Players may load in solutions from Puzzle 1657. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 13,606
  2. Avatar for GENE 433 12. GENE 433 1 pt. 13,067
  3. Avatar for freefolder 13. freefolder 1 pt. 12,223
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 11,544
  5. Avatar for DW 2020 15. DW 2020 1 pt. 11,148
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 8,494
  7. Avatar for MBB190 17. MBB190 1 pt. 4,884
  1. Avatar for aznarog 81. aznarog Lv 1 2 pts. 12,015
  2. Avatar for felixxy 82. felixxy Lv 1 2 pts. 11,990
  3. Avatar for johngran 83. johngran Lv 1 2 pts. 11,909
  4. Avatar for poiuytrewq987 84. poiuytrewq987 Lv 1 2 pts. 11,903
  5. Avatar for ManVsYard 85. ManVsYard Lv 1 2 pts. 11,898
  6. Avatar for Dhalion 86. Dhalion Lv 1 2 pts. 11,849
  7. Avatar for rinze 87. rinze Lv 1 2 pts. 11,820
  8. Avatar for harvardman 88. harvardman Lv 1 2 pts. 11,790
  9. Avatar for Squirrely 89. Squirrely Lv 1 1 pt. 11,752
  10. Avatar for rezaefar 90. rezaefar Lv 1 1 pt. 11,626

Comments