Placeholder image of a protein
Icon representing a puzzle

1670: Unsolved De-novo Freestyle 150: Symmetric Dimer

Closed since almost 7 years ago

Intermediate Overall Prediction Symmetry

Summary


Created
May 06, 2019
Expires
Max points
100
Description

This is a follow-up to Puzzle 1657: De-novo Freestyle 150, now with C2 symmetry. This protein was originally designed by a Foldit player as a symmetric dimer. In Puzzle 1657, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the original protein was designed to fold and bind to itself with C2 symmetry. Players may load in solutions from Puzzle 1657. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 14,712
  2. Avatar for Contenders 2. Contenders 73 pts. 14,707
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 14,635
  4. Avatar for Go Science 4. Go Science 36 pts. 14,467
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 14,418
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 14,190
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 14,150
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 14,144
  9. Avatar for Russian team 9. Russian team 4 pts. 14,041
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 13,993

  1. Avatar for actiasluna 21. actiasluna Lv 1 1 pt. 14,150
  2. Avatar for Blipperman 22. Blipperman Lv 1 1 pt. 14,134
  3. Avatar for Skippysk8s 23. Skippysk8s Lv 1 1 pt. 14,132
  4. Avatar for georg137 24. georg137 Lv 1 1 pt. 14,121
  5. Avatar for ManVsYard 25. ManVsYard Lv 1 1 pt. 14,112
  6. Avatar for Aminal88 26. Aminal88 Lv 1 1 pt. 13,907

Comments