Placeholder image of a protein
Icon representing a puzzle

1671: Revisiting Puzzle 135: E. coli

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
May 07, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 9,397
  2. Avatar for Hold My Beer 12. Hold My Beer 3 pts. 9,394
  3. Avatar for freefolder 13. freefolder 2 pts. 9,155
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,137
  5. Avatar for GENE 433 15. GENE 433 1 pt. 8,963
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,911
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 8,833
  8. Avatar for I3L GANG 18. I3L GANG 1 pt. 8,745
  9. Avatar for Coastal Biochemistry 19. Coastal Biochemistry 1 pt. 7,732
  10. Avatar for MBB190 20. MBB190 1 pt. 7,559

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,807
  2. Avatar for smilingone 2. smilingone Lv 1 77 pts. 9,797
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 58 pts. 9,775
  4. Avatar for reefyrob 4. reefyrob Lv 1 43 pts. 9,768
  5. Avatar for toshiue 5. toshiue Lv 1 31 pts. 9,764
  6. Avatar for silent gene 6. silent gene Lv 1 22 pts. 9,762
  7. Avatar for Hollinas 7. Hollinas Lv 1 15 pts. 9,760
  8. Avatar for Phyx 8. Phyx Lv 1 11 pts. 9,730
  9. Avatar for Deleted player 9. Deleted player pts. 9,693
  10. Avatar for lamoille 10. lamoille Lv 1 5 pts. 9,688

Comments