Placeholder image of a protein
Icon representing a puzzle

1671: Revisiting Puzzle 135: E. coli

Closed since almost 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
May 07, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Beta Folders 100 pts. 9,807
  2. Avatar for Go Science 2. Go Science 79 pts. 9,775
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,718
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 47 pts. 9,700
  5. Avatar for Gargleblasters 5. Gargleblasters 35 pts. 9,690
  6. Avatar for Marvin's bunch 6. Marvin's bunch 26 pts. 9,654
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,611
  8. Avatar for Void Crushers 8. Void Crushers 14 pts. 9,588
  9. Avatar for Contenders 9. Contenders 10 pts. 9,583
  10. Avatar for Russian team 10. Russian team 7 pts. 9,579

  1. Avatar for lconor 91. lconor Lv 1 2 pts. 8,962
  2. Avatar for Vmou 92. Vmou Lv 1 2 pts. 8,961
  3. Avatar for cobaltteal 93. cobaltteal Lv 1 2 pts. 8,943
  4. Avatar for ourtown 94. ourtown Lv 1 2 pts. 8,924
  5. Avatar for toshiue 95. toshiue Lv 1 2 pts. 8,915
  6. Avatar for aspadistra 96. aspadistra Lv 1 2 pts. 8,911
  7. Avatar for fearjuan 97. fearjuan Lv 1 2 pts. 8,906
  8. Avatar for nadinelim 98. nadinelim Lv 1 2 pts. 8,899
  9. Avatar for Knoblerine 99. Knoblerine Lv 1 1 pt. 8,888
  10. Avatar for Pawel Tluscik 100. Pawel Tluscik Lv 1 1 pt. 8,886

Comments