Placeholder image of a protein
Icon representing a puzzle

1673: Unsolved De-novo Freestyle 152

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GVIIVWDKDLNIVIIVILDTQQVYVVHDEDEKVKEMRKKIEEVMRRSQDEEEIERQIWRLLEEMK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,650
  2. Avatar for Marvin's bunch 12. Marvin's bunch 1 pt. 9,589
  3. Avatar for GENE 433 13. GENE 433 1 pt. 9,280
  4. Avatar for freefolder 14. freefolder 1 pt. 9,161
  5. Avatar for I3L GANG 15. I3L GANG 1 pt. 7,252
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 6,567
  1. Avatar for actiasluna
    1. actiasluna Lv 1
    100 pts. 10,168
  2. Avatar for Steven Pletsch 2. Steven Pletsch Lv 1 97 pts. 9,987
  3. Avatar for Skippysk8s 3. Skippysk8s Lv 1 93 pts. 9,970
  4. Avatar for LociOiling 4. LociOiling Lv 1 89 pts. 9,960
  5. Avatar for tyler0911 5. tyler0911 Lv 1 86 pts. 9,945
  6. Avatar for christioanchauvin 6. christioanchauvin Lv 1 82 pts. 9,929
  7. Avatar for fiendish_ghoul 7. fiendish_ghoul Lv 1 79 pts. 9,917
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 76 pts. 9,909
  9. Avatar for Threeoak 9. Threeoak Lv 1 73 pts. 9,897
  10. Avatar for phi16 10. phi16 Lv 1 70 pts. 9,889

Comments