Placeholder image of a protein
Icon representing a puzzle

1673: Unsolved De-novo Freestyle 152

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GVIIVWDKDLNIVIIVILDTQQVYVVHDEDEKVKEMRKKIEEVMRRSQDEEEIERQIWRLLEEMK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,650
  2. Avatar for Marvin's bunch 12. Marvin's bunch 1 pt. 9,589
  3. Avatar for GENE 433 13. GENE 433 1 pt. 9,280
  4. Avatar for freefolder 14. freefolder 1 pt. 9,161
  5. Avatar for I3L GANG 15. I3L GANG 1 pt. 7,252
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 6,567
  1. Avatar for actiasluna
    1. actiasluna Lv 1
    100 pts. 10,165
  2. Avatar for Blipperman 2. Blipperman Lv 1 79 pts. 10,162
  3. Avatar for StackOverflow 3. StackOverflow Lv 1 61 pts. 10,161
  4. Avatar for ManVsYard 4. ManVsYard Lv 1 47 pts. 10,159
  5. Avatar for Skippysk8s 5. Skippysk8s Lv 1 35 pts. 10,153
  6. Avatar for Aminal88 6. Aminal88 Lv 1 26 pts. 9,973
  7. Avatar for phi16 7. phi16 Lv 1 19 pts. 9,958
  8. Avatar for robgee 8. robgee Lv 1 14 pts. 9,938
  9. Avatar for LociOiling 9. LociOiling Lv 1 10 pts. 9,934
  10. Avatar for smilingone 10. smilingone Lv 1 7 pts. 9,928

Comments