Placeholder image of a protein
Icon representing a puzzle

1673: Unsolved De-novo Freestyle 152

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GVIIVWDKDLNIVIIVILDTQQVYVVHDEDEKVKEMRKKIEEVMRRSQDEEEIERQIWRLLEEMK

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,168
  2. Avatar for Hold My Beer 2. Hold My Beer 71 pts. 9,987
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 9,960
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 9,958
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 9,929
  6. Avatar for Go Science 6. Go Science 14 pts. 9,909
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,831
  8. Avatar for Russian team 8. Russian team 5 pts. 9,749
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,723
  10. Avatar for Contenders 10. Contenders 2 pts. 9,709
  1. Avatar for reefyrob 11. reefyrob Lv 1 4 pts. 9,920
  2. Avatar for lamoille 12. lamoille Lv 1 3 pts. 9,920
  3. Avatar for Bruno Kestemont 13. Bruno Kestemont Lv 1 2 pts. 9,905
  4. Avatar for toshiue 14. toshiue Lv 1 1 pt. 9,893
  5. Avatar for silent gene 15. silent gene Lv 1 1 pt. 9,877
  6. Avatar for Deleted player 16. Deleted player pts. 9,843
  7. Avatar for alcor29 17. alcor29 Lv 1 1 pt. 9,840
  8. Avatar for retiredmichael 18. retiredmichael Lv 1 1 pt. 9,789
  9. Avatar for Hollinas 19. Hollinas Lv 1 1 pt. 9,746
  10. Avatar for georg137 20. georg137 Lv 1 1 pt. 9,700

Comments