Placeholder image of a protein
Icon representing a puzzle

1673: Unsolved De-novo Freestyle 152

Closed since almost 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
May 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GVIIVWDKDLNIVIIVILDTQQVYVVHDEDEKVKEMRKKIEEVMRRSQDEEEIERQIWRLLEEMK

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,168
  2. Avatar for Hold My Beer 2. Hold My Beer 71 pts. 9,987
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 9,960
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 9,958
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 9,929
  6. Avatar for Go Science 6. Go Science 14 pts. 9,909
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,831
  8. Avatar for Russian team 8. Russian team 5 pts. 9,749
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,723
  10. Avatar for Contenders 10. Contenders 2 pts. 9,709

  1. Avatar for actiasluna
    1. actiasluna Lv 1
    100 pts. 10,168
  2. Avatar for Steven Pletsch 2. Steven Pletsch Lv 1 97 pts. 9,987
  3. Avatar for Skippysk8s 3. Skippysk8s Lv 1 93 pts. 9,970
  4. Avatar for LociOiling 4. LociOiling Lv 1 89 pts. 9,960
  5. Avatar for tyler0911 5. tyler0911 Lv 1 86 pts. 9,945
  6. Avatar for christioanchauvin 6. christioanchauvin Lv 1 82 pts. 9,929
  7. Avatar for fiendish_ghoul 7. fiendish_ghoul Lv 1 79 pts. 9,917
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 76 pts. 9,909
  9. Avatar for Threeoak 9. Threeoak Lv 1 73 pts. 9,897
  10. Avatar for phi16 10. phi16 Lv 1 70 pts. 9,889

Comments