1674: Revisiting Puzzle 136: Cell Adhesion
Closed since almost 7 years ago
Novice Overall PredictionSummary
- Created
- May 14, 2019
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT
Top groups
-
1. nicobul Lv 1100 pts. 9,977
-
-
-
-
-
-
-
-
-
Comments
vakobo Lv 1
I've got a state in this puzzle when 1 move permanently crashes linux client. Should is share it to scientists?
bkoep Staff Lv 1
Can you also tell us what move causes Foldit to crash? Do you have log.txt output from the crash?
vakobo Lv 1
Save name 'ready to crash'.
Necessary action is described in save comments - pull down rightmost cysteine which is connected with rubber band to another one.