Placeholder image of a protein
Icon representing a puzzle

1674: Revisiting Puzzle 136: Cell Adhesion

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
May 14, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 9,299
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,933
  3. Avatar for Extraterrestrials 2.0 13. Extraterrestrials 2.0 1 pt. 8,748
  4. Avatar for freefolder 14. freefolder 1 pt. 8,556
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,377
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 8,066
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,782

  1. Avatar for rinze 91. rinze Lv 1 1 pt. 8,266
  2. Avatar for Pawel Tluscik 92. Pawel Tluscik Lv 1 1 pt. 8,203
  3. Avatar for JugrenisII 93. JugrenisII Lv 1 1 pt. 8,196
  4. Avatar for Undefined24 94. Undefined24 Lv 1 1 pt. 8,183
  5. Avatar for Auntecedent 96. Auntecedent Lv 1 1 pt. 8,154
  6. Avatar for ace142 97. ace142 Lv 1 1 pt. 8,142
  7. Avatar for Arne Heessels 98. Arne Heessels Lv 1 1 pt. 8,118
  8. Avatar for felixxy 99. felixxy Lv 1 1 pt. 8,116
  9. Avatar for rol 100. rol Lv 1 1 pt. 8,113

Comments


vakobo Lv 1

I've got a state in this puzzle when 1 move permanently crashes linux client. Should is share it to scientists?

bkoep Staff Lv 1

Can you also tell us what move causes Foldit to crash? Do you have log.txt output from the crash?

vakobo Lv 1

Save name 'ready to crash'.
Necessary action is described in save comments - pull down rightmost cysteine which is connected with rubber band to another one.