Placeholder image of a protein
Icon representing a puzzle

1674: Revisiting Puzzle 136: Cell Adhesion

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
May 14, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 9,299
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,933
  3. Avatar for Extraterrestrials 2.0 13. Extraterrestrials 2.0 1 pt. 8,748
  4. Avatar for freefolder 14. freefolder 1 pt. 8,556
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,377
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 8,066
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,782
  1. Avatar for JasperD 121. JasperD Lv 1 1 pt. 7,625
  2. Avatar for Phil8 122. Phil8 Lv 1 1 pt. 7,623
  3. Avatar for leannerikicheever 123. leannerikicheever Lv 1 1 pt. 7,614
  4. Avatar for dd-2 124. dd-2 Lv 1 1 pt. 7,577
  5. Avatar for Willyanto 125. Willyanto Lv 1 1 pt. 7,522
  6. Avatar for Philippe_C 126. Philippe_C Lv 1 1 pt. 7,513
  7. Avatar for Vmou 127. Vmou Lv 1 1 pt. 7,485
  8. Avatar for StackOverflow 128. StackOverflow Lv 1 1 pt. 7,477
  9. Avatar for Bluriv 129. Bluriv Lv 1 1 pt. 7,261
  10. Avatar for jamiexq 130. jamiexq Lv 1 1 pt. 7,100

Comments

vakobo Lv 1

I've got a state in this puzzle when 1 move permanently crashes linux client. Should is share it to scientists?

bkoep Staff Lv 1

Can you also tell us what move causes Foldit to crash? Do you have log.txt output from the crash?

vakobo Lv 1

Save name 'ready to crash'.
Necessary action is described in save comments - pull down rightmost cysteine which is connected with rubber band to another one.