Placeholder image of a protein
Icon representing a puzzle

1674: Revisiting Puzzle 136: Cell Adhesion

Closed since almost 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
May 14, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 10,028
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,932
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,924
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 9,844
  5. Avatar for HMT heritage 5. HMT heritage 24 pts. 9,799
  6. Avatar for Go Science 6. Go Science 16 pts. 9,793
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 9,704
  8. Avatar for Russian team 8. Russian team 6 pts. 9,591
  9. Avatar for Contenders 9. Contenders 4 pts. 9,535
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 9,474

  1. Avatar for johngran 71. johngran Lv 1 5 pts. 8,714
  2. Avatar for MrZanav 72. MrZanav Lv 1 4 pts. 8,701
  3. Avatar for georg137 73. georg137 Lv 1 4 pts. 8,690
  4. Avatar for lconor 74. lconor Lv 1 4 pts. 8,680
  5. Avatar for poiuytrewq987 75. poiuytrewq987 Lv 1 4 pts. 8,613
  6. Avatar for jebbiek 76. jebbiek Lv 1 3 pts. 8,590
  7. Avatar for 181818 77. 181818 Lv 1 3 pts. 8,589
  8. Avatar for Altercomp 78. Altercomp Lv 1 3 pts. 8,556
  9. Avatar for yasmin_waydzik 79. yasmin_waydzik Lv 1 3 pts. 8,522
  10. Avatar for harvardman 80. harvardman Lv 1 3 pts. 8,501

Comments


vakobo Lv 1

I've got a state in this puzzle when 1 move permanently crashes linux client. Should is share it to scientists?

bkoep Staff Lv 1

Can you also tell us what move causes Foldit to crash? Do you have log.txt output from the crash?

vakobo Lv 1

Save name 'ready to crash'.
Necessary action is described in save comments - pull down rightmost cysteine which is connected with rubber band to another one.