Placeholder image of a protein
Icon representing a puzzle

1677: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
May 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 11,156
  2. Avatar for DW 2020 12. DW 2020 1 pt. 10,940
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,938
  4. Avatar for freefolder 14. freefolder 1 pt. 10,677
  5. Avatar for Extraterrestrials 2.0 15. Extraterrestrials 2.0 1 pt. 10,615
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 10,224
  7. Avatar for CH4110 Fold it! 17. CH4110 Fold it! 1 pt. 9,529

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,905
  2. Avatar for crpainter 2. crpainter Lv 1 97 pts. 11,686
  3. Avatar for johnmitch 3. johnmitch Lv 1 93 pts. 11,652
  4. Avatar for tyler0911 4. tyler0911 Lv 1 90 pts. 11,614
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 87 pts. 11,577
  6. Avatar for grogar7 6. grogar7 Lv 1 83 pts. 11,574
  7. Avatar for Galaxie 7. Galaxie Lv 1 80 pts. 11,563
  8. Avatar for Phyx 8. Phyx Lv 1 77 pts. 11,541
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 74 pts. 11,536
  10. Avatar for actiasluna 10. actiasluna Lv 1 72 pts. 11,529

Comments