Placeholder image of a protein
Icon representing a puzzle

1677: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
May 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 11,156
  2. Avatar for DW 2020 12. DW 2020 1 pt. 10,940
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,938
  4. Avatar for freefolder 14. freefolder 1 pt. 10,677
  5. Avatar for Extraterrestrials 2.0 15. Extraterrestrials 2.0 1 pt. 10,615
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 10,224
  7. Avatar for CH4110 Fold it! 17. CH4110 Fold it! 1 pt. 9,529
  1. Avatar for Arne Heessels 111. Arne Heessels Lv 1 1 pt. 10,082
  2. Avatar for hajtogato 112. hajtogato Lv 1 1 pt. 10,077
  3. Avatar for JugrenisII 113. JugrenisII Lv 1 1 pt. 10,052
  4. Avatar for maniacman59 114. maniacman59 Lv 1 1 pt. 9,981
  5. Avatar for leannerikicheever 115. leannerikicheever Lv 1 1 pt. 9,960
  6. Avatar for GUANINJIN 116. GUANINJIN Lv 1 1 pt. 9,914
  7. Avatar for Willyanto 117. Willyanto Lv 1 1 pt. 9,795
  8. Avatar for YHWan2019 118. YHWan2019 Lv 1 1 pt. 9,529
  9. Avatar for Starpool 119. Starpool Lv 1 1 pt. 9,453
  10. Avatar for Squirrely 120. Squirrely Lv 1 1 pt. 9,384

Comments