Placeholder image of a protein
Icon representing a puzzle

1677: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
May 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 11,156
  2. Avatar for DW 2020 12. DW 2020 1 pt. 10,940
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,938
  4. Avatar for freefolder 14. freefolder 1 pt. 10,677
  5. Avatar for Extraterrestrials 2.0 15. Extraterrestrials 2.0 1 pt. 10,615
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 10,224
  7. Avatar for CH4110 Fold it! 17. CH4110 Fold it! 1 pt. 9,529

  1. Avatar for erexer 121. erexer Lv 1 1 pt. 9,349
  2. Avatar for dgibbard 122. dgibbard Lv 1 1 pt. 9,327
  3. Avatar for Reelix 123. Reelix Lv 1 1 pt. 9,305
  4. Avatar for aheadofthefold 124. aheadofthefold Lv 1 1 pt. 9,247
  5. Avatar for kyleg 125. kyleg Lv 1 1 pt. 9,102
  6. Avatar for 01010011111 126. 01010011111 Lv 1 1 pt. 8,715
  7. Avatar for mberna00 127. mberna00 Lv 1 1 pt. 8,656
  8. Avatar for kimet18 128. kimet18 Lv 1 1 pt. 8,507
  9. Avatar for aka_bkoep 129. aka_bkoep Lv 1 1 pt. 8,438
  10. Avatar for altejoh 130. altejoh Lv 1 1 pt. 8,438

Comments