Placeholder image of a protein
Icon representing a puzzle

1677: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
May 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 11,156
  2. Avatar for DW 2020 12. DW 2020 1 pt. 10,940
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,938
  4. Avatar for freefolder 14. freefolder 1 pt. 10,677
  5. Avatar for Extraterrestrials 2.0 15. Extraterrestrials 2.0 1 pt. 10,615
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 10,224
  7. Avatar for CH4110 Fold it! 17. CH4110 Fold it! 1 pt. 9,529

  1. Avatar for nicobul 21. nicobul Lv 1 46 pts. 11,432
  2. Avatar for Aminal88 22. Aminal88 Lv 1 44 pts. 11,430
  3. Avatar for Deleted player 23. Deleted player pts. 11,426
  4. Avatar for Timo van der Laan 24. Timo van der Laan Lv 1 40 pts. 11,420
  5. Avatar for tarimo 25. tarimo Lv 1 38 pts. 11,399
  6. Avatar for silent gene 26. silent gene Lv 1 37 pts. 11,388
  7. Avatar for dcrwheeler 27. dcrwheeler Lv 1 35 pts. 11,367
  8. Avatar for guineapig 28. guineapig Lv 1 34 pts. 11,349
  9. Avatar for fiendish_ghoul 29. fiendish_ghoul Lv 1 32 pts. 11,341
  10. Avatar for aznarog 30. aznarog Lv 1 31 pts. 11,337

Comments