Placeholder image of a protein
Icon representing a puzzle

1677: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
May 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 11,156
  2. Avatar for DW 2020 12. DW 2020 1 pt. 10,940
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,938
  4. Avatar for freefolder 14. freefolder 1 pt. 10,677
  5. Avatar for Extraterrestrials 2.0 15. Extraterrestrials 2.0 1 pt. 10,615
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 10,224
  7. Avatar for CH4110 Fold it! 17. CH4110 Fold it! 1 pt. 9,529
  1. Avatar for christioanchauvin 31. christioanchauvin Lv 1 29 pts. 11,292
  2. Avatar for joremen 32. joremen Lv 1 28 pts. 11,292
  3. Avatar for anthion 33. anthion Lv 1 27 pts. 11,278
  4. Avatar for diamonddays 34. diamonddays Lv 1 25 pts. 11,265
  5. Avatar for jtrube1 35. jtrube1 Lv 1 24 pts. 11,252
  6. Avatar for pvc78 36. pvc78 Lv 1 23 pts. 11,252
  7. Avatar for vakobo 37. vakobo Lv 1 22 pts. 11,217
  8. Avatar for Deleted player 38. Deleted player 21 pts. 11,214
  9. Avatar for Norrjane 39. Norrjane Lv 1 20 pts. 11,211
  10. Avatar for Anfinsen_slept_here 40. Anfinsen_slept_here Lv 1 19 pts. 11,202

Comments