Placeholder image of a protein
Icon representing a puzzle

1677: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
May 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 11,156
  2. Avatar for DW 2020 12. DW 2020 1 pt. 10,940
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,938
  4. Avatar for freefolder 14. freefolder 1 pt. 10,677
  5. Avatar for Extraterrestrials 2.0 15. Extraterrestrials 2.0 1 pt. 10,615
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 10,224
  7. Avatar for CH4110 Fold it! 17. CH4110 Fold it! 1 pt. 9,529
  1. Avatar for martin.kendig@verizon.net 41. martin.kendig@verizon.net Lv 1 18 pts. 11,202
  2. Avatar for jausmh 42. jausmh Lv 1 17 pts. 11,199
  3. Avatar for toshiue 43. toshiue Lv 1 16 pts. 11,191
  4. Avatar for Merf 44. Merf Lv 1 15 pts. 11,169
  5. Avatar for O Seki To 45. O Seki To Lv 1 15 pts. 11,156
  6. Avatar for DoctorSockrates 46. DoctorSockrates Lv 1 14 pts. 11,146
  7. Avatar for Idiotboy 47. Idiotboy Lv 1 13 pts. 11,146
  8. Avatar for stomjoh 48. stomjoh Lv 1 13 pts. 11,146
  9. Avatar for WBarme1234 49. WBarme1234 Lv 1 12 pts. 11,144
  10. Avatar for alcor29 50. alcor29 Lv 1 11 pts. 11,128

Comments