Placeholder image of a protein
Icon representing a puzzle

1677: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
May 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 11,156
  2. Avatar for DW 2020 12. DW 2020 1 pt. 10,940
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,938
  4. Avatar for freefolder 14. freefolder 1 pt. 10,677
  5. Avatar for Extraterrestrials 2.0 15. Extraterrestrials 2.0 1 pt. 10,615
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 10,224
  7. Avatar for CH4110 Fold it! 17. CH4110 Fold it! 1 pt. 9,529

  1. Avatar for jamiexq 51. jamiexq Lv 1 11 pts. 11,118
  2. Avatar for ReallyRatherDumb 52. ReallyRatherDumb Lv 1 10 pts. 11,111
  3. Avatar for Alistair69 53. Alistair69 Lv 1 9 pts. 11,109
  4. Avatar for Marvelz 54. Marvelz Lv 1 9 pts. 11,090
  5. Avatar for Museka 55. Museka Lv 1 8 pts. 11,084
  6. Avatar for cbwest 56. cbwest Lv 1 8 pts. 11,078
  7. Avatar for alwen 57. alwen Lv 1 8 pts. 11,056
  8. Avatar for Flagg65a 58. Flagg65a Lv 1 7 pts. 11,037
  9. Avatar for benrh 59. benrh Lv 1 7 pts. 11,036
  10. Avatar for cobaltteal 60. cobaltteal Lv 1 6 pts. 11,027

Comments