Placeholder image of a protein
Icon representing a puzzle

1677: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
May 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 11,156
  2. Avatar for DW 2020 12. DW 2020 1 pt. 10,940
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,938
  4. Avatar for freefolder 14. freefolder 1 pt. 10,677
  5. Avatar for Extraterrestrials 2.0 15. Extraterrestrials 2.0 1 pt. 10,615
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 10,224
  7. Avatar for CH4110 Fold it! 17. CH4110 Fold it! 1 pt. 9,529
  1. Avatar for ManVsYard 61. ManVsYard Lv 1 6 pts. 11,026
  2. Avatar for ANaturalPhilosopher 62. ANaturalPhilosopher Lv 1 6 pts. 11,020
  3. Avatar for Pawel Tluscik 63. Pawel Tluscik Lv 1 5 pts. 11,019
  4. Avatar for mitarcher 64. mitarcher Lv 1 5 pts. 11,004
  5. Avatar for orily1337 65. orily1337 Lv 1 5 pts. 11,002
  6. Avatar for Deleted player 66. Deleted player pts. 10,971
  7. Avatar for pmoulthrop 67. pmoulthrop Lv 1 4 pts. 10,966
  8. Avatar for heather-1 68. heather-1 Lv 1 4 pts. 10,942
  9. Avatar for SiPot2018 69. SiPot2018 Lv 1 4 pts. 10,940
  10. Avatar for Hiro Protagonist 70. Hiro Protagonist Lv 1 3 pts. 10,938

Comments