Placeholder image of a protein
Icon representing a puzzle

1677: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
May 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 11,156
  2. Avatar for DW 2020 12. DW 2020 1 pt. 10,940
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,938
  4. Avatar for freefolder 14. freefolder 1 pt. 10,677
  5. Avatar for Extraterrestrials 2.0 15. Extraterrestrials 2.0 1 pt. 10,615
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 10,224
  7. Avatar for CH4110 Fold it! 17. CH4110 Fold it! 1 pt. 9,529
  1. Avatar for Dantoto 71. Dantoto Lv 1 3 pts. 10,936
  2. Avatar for Lyshi2018 72. Lyshi2018 Lv 1 3 pts. 10,931
  3. Avatar for StackOverflow 73. StackOverflow Lv 1 3 pts. 10,924
  4. Avatar for Artoria2e5 74. Artoria2e5 Lv 1 3 pts. 10,913
  5. Avatar for poiuytrewq987 75. poiuytrewq987 Lv 1 2 pts. 10,910
  6. Avatar for Deleted player 76. Deleted player pts. 10,900
  7. Avatar for yasmin_waydzik 77. yasmin_waydzik Lv 1 2 pts. 10,899
  8. Avatar for ScyllaHide 78. ScyllaHide Lv 1 2 pts. 10,886
  9. Avatar for nlachance 79. nlachance Lv 1 2 pts. 10,870
  10. Avatar for Vinara 80. Vinara Lv 1 2 pts. 10,864

Comments